PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 473aa    MW: 53682.6 Da    PI: 5.9912
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1531genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-121356144
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +g+W +eEde l++ vk++G++ W++I ++  + Rt+k+c++rw
      Gh_D08G1531 13 KGPWKAEEDEVLINHVKKYGPREWSSIRSKGLLQRTGKSCRLRW 56
                     79*************************8887799********** PP

2Myb_DNA-binding40.75.6e-13208253146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+W +eEde l++ vk++G++ W++I ++  + Rt+k+c++rw +
      Gh_D08G1531 208 KGPWKAEEDEVLINHVKKYGPREWSSIRSKGLLQRTGKSCRLRWVN 253
                      79*************************8887799**********87 PP

3Myb_DNA-binding44.63.4e-14264303344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      ++T+eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
      Gh_D08G1531 264 KFTAEEERVVIELQAQFGNK-WAKIATYLP-GRTDNDVKNFW 303
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.032864IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-181062IPR009057Homeodomain-like
SuperFamilySSF466892.69E-121160IPR009057Homeodomain-like
SMARTSM007178.0E-71262IPR001005SANT/Myb domain
CDDcd001678.79E-101556No hitNo description
PfamPF139212.5E-101671No hitNo description
PROSITE profilePS5129414.714203255IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-20204256IPR009057Homeodomain-like
SuperFamilySSF466893.95E-28206303IPR009057Homeodomain-like
SMARTSM007174.4E-10207257IPR001005SANT/Myb domain
CDDcd001672.58E-10210255No hitNo description
PfamPF139212.1E-11211261No hitNo description
PROSITE profilePS5129420.671256311IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-18257309IPR009057Homeodomain-like
SMARTSM007175.9E-13261309IPR001005SANT/Myb domain
CDDcd001671.03E-10264303No hitNo description
PfamPF002492.3E-12264303IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MEGKLVEISQ IRKGPWKAEE DEVLINHVKK YGPREWSSIR SKGLLQRTGK SCRLRWAPKL  60
SSSMEEISYT MAQSCSSSSY LDNTETIIKV EQFPKLVNPK LYTDANMAQL ELMSIGNNPY  120
AAAEAQPQAF FPQTPHPQPY LTLSLESQDL LAKFEDPYFS QVFAPMDVHE LDSGNVEQQP  180
FLEPVRSDSR VKLGEMEGKR VEISQIRKGP WKAEEDEVLI NHVKKYGPRE WSSIRSKGLL  240
QRTGKSCRLR WVNKLRPNLK NGCKFTAEEE RVVIELQAQF GNKWAKIATY LPGRTDNDVK  300
NFWSSRQKRL ARILQNSGAP SSSSSSSSSK SLKLKREIPA FHDVPVFECF FGIILVTFVV  360
WGLIXNPYAA AEAQPQAFFP QTPHPQPYLT LSLESQDLLA KFEDPYFSQV FAPMDVHELD  420
SGNVEQQPFL EPVRSGGFGA REEADNPMIP DAFFDDFPAD MFDQMEPLPN PST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-2919930918126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5884501e-103JX588450.1 Gossypium hirsutum clone NBRI_GE22878 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475348.11e-169PREDICTED: transcription factor LAF1
TrEMBLA0A0D2S0S51e-172A0A0D2S0S5_G
STRINGVIT_15s0021g02040.t011e-98(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-71MYB family protein